Sign In | Join Free | My fnxradio.com
fnxradio.com
Products
Search by Category
Home > Food & Beverage > Honey Products > Honey >

Bee Pollen Honey

bee pollen honey

All bee pollen honey wholesalers & bee pollen honey manufacturers come from members. We doesn't provide bee pollen honey products or service, please contact them directly and verify their companies info carefully.

Total 783 products from bee pollen honey Manufactures & Suppliers
Wholesale Mixed Sun Flower Bee Pollen Honey Bee Products Full Of Nutricion Big Granual from china suppliers

Brand Name:Bee Star

Model Number:HN-287-1

Place of Origin:China

...Mixed Sun Flower Bee Pollen of Honey Bee Products Descriptions of Mixed Sun Flower Bee Pollen: Bee pollen is a ball or pellet of field-gathered flower pollen packed by worker honeybees, and used as the primary food source for...

Bee Star-----------Make Your Bees Be Great Star
Verified Supplier

Sichuan

Wholesale pure clean rape bee pollen powder good for human consumption from china suppliers

Place of Origin:Xuchang

Brand Name:bee pollen

Model Number:2001

...pure clean rape bee pollen powder good for human consumption Product Description Product name Bee Pollen Appearance Light yellow block powder Odor Characteristic Taste Characteristic Active Ingredient Protein, Amino Acid, Vitamin, ...

Henan Super-Sweet Biotechnology Co., Ltd
Verified Supplier

Henan

Wholesale Fresh Organic  Bee Pollen Powder 100% Rape Flower Extract 18% Protein from china suppliers

Brand Name:Y-Herb

Model Number:99%

Place of Origin:China

... Extract Bee Pollen Powder Bee pollen is rich in natural vitamins and minerals and also highly concentrated.It contains all the necessary nutrients of the human body which do good to our health! Bee pollen has...

Shaanxi Y-Herb Biotechnology Co., Ltd.
Verified Supplier

Wholesale Etumax Royal Honey For Him male enhancement with royal jelly bee pollen from china suppliers

Brand Name:Etumax Royal Honey For Him male enhancement with royal jelly bee pollen

Model Number:Etumax Royal Honey For Him male enhancement with royal jelly bee pollen

Place of Origin:hongkong

... Honey For Him Is an instant source of energy to enhance male vitality. Pure honey fortified with selected mixture of rainforest herbs (Tongkat Ali and Ginseng) Nutritious honey enriched with vital biomolecules in, Bee...

Green healthy living international co., LTD
Verified Supplier

Hongkong

Wholesale Newest natrual multi-flower rape bee pollen from china suppliers

Place of Origin:Xuchang

Brand Name:bee pollen

Model Number:2001

...Newest natrual multi-flower rape bee pollen We could mix different kinds of pollen according customer`s requirement . For example : 60% rape pollen + 10% camellia pollen + 20% sunflowers+10% other bee pollen Please send us your requirement for...

Henan Super-Sweet Biotechnology Co., Ltd
Site Member

Henan

Wholesale Bee Pollen Honey Soft Drink from china suppliers

Brand Name:Bee earth

Place of Origin:China

...BEE POLLEN HONEY SOFT DRINK is made of non-pollution raw materials from Qinghai-Tibet plateau without artificial additions in healthy formula and advanced process. Main Ingredients Water, Honey, White sugar, Bee pollen (broken-wall bee pollen, lotus pollen...

Guangzhou Herb & Bee Products Co., Ltd
Active Member

Guangdong

Wholesale fengqiuyinliao Bee pollen & Honey Soft drink from china suppliers

Categories:Bee Pollen Weight Loss Pills

Telephone:86-020-38248144 38312454 38370184, 86-20-38248144 38312454 38370184

Country/Region:china

Product Name: Bee pollen & Honey Soft drink Physics and Chemistry Parameter: Chinese Standard Specification: 250ML Bee pollen & Honey Soft drink

Guangzhou Herb &Bee Products Co. Ltd
ICP Remarked Supplier

Wholesale Bee pollen granules, Pollen granules, pollen pellet from china suppliers

Place of Origin:China

Brand Name:Zhanjo

Model Number:ZJ-1001

...: Bee pollen is the pollen agglomerate which was collected from plant and processed by bees, and was called almighty nutrition food, concentrated natural drug storeroom, to be taken orally cosmetic, concentrated amino acid etc, bee pollen...

Anhui Zhanjo Natural Product Co.,ltd
Site Member

Anhui

Wholesale pure clean rape bee pollen powder good for human consumption from china suppliers

Place of Origin:Xuchang

Brand Name:bee pollen

Model Number:2001

...pure clean rape bee pollen powder good for human consumption Product Description Product name Bee Pollen Appearance Light yellow block powder Odor Characteristic Taste Characteristic Active Ingredient Protein, Amino Acid, Vitamin, ...

Henan Super-Sweet Imp.&Exp. Trading Co., Ltd
Site Member

Henan

Wholesale Chinese Natural Salable Bee Pollen from china suppliers

Place of Origin:China

Brand Name:Weikang

...Function: 1. Promote the metabolism of skin cell and defer the cell senescence; 2. Bee pollen has the positive adjustment of nervous system which keep the head high energy; 3. Promote the ...

Henan Weikang Bee Industry Co.,Ltd.
Active Member

Henan

Wholesale High Quality Cheap Price Mixed Bee Pollen from china suppliers

Place of Origin:China

Brand Name:Fumei

Model Number:FMB201208241

... Description 1. long-term supply rape/tea/mixed bee pollen 2. free sample of rape/tea/mixed bee pollen available WhatisBeePollen? Beepollencontainstraceamountsofmineralsandvitaminsandisveryhighinproteinandcarbohydrates. Beepollenisnotfoundintheeverydaydiet...

Henan Fumei Bio - Technology Co., Ltd
Active Member

Henan

Wholesale Supply High Quality Bee Pollen Powder from china suppliers

Place of Origin:China

Brand Name:Reindeer

Model Number:Bee Pollen

...Product name Bee Pollen For Granules Description 1).Bees take pollen from the anthers on the flowers 2). The pollen is mixed with little honey and saliva secretions and made it into pollen bunch which is brought back to...

Reindeer Biotech Co.,ltd
Active Member

Hunan

Wholesale Bee pollen granules, Pollen granules, pollen pellet from china suppliers

Place of Origin:China

Brand Name:Zhanjo

Model Number:ZJ-1001

...: Bee pollen is the pollen agglomerate which was collected from plant and processed by bees, and was called almighty nutrition food, concentrated natural drug storeroom, to be taken orally cosmetic, concentrated amino acid etc, bee pollen...

Anhui Zhanjo Natural Products Co.,Ltd
Site Member

Anhui

Wholesale Health Certificate Fresh Bee Pollen From China from china suppliers

Place of Origin:Henan

Brand Name:Weikang

Model Number:WK-B0052

... bees collect for food; Bee pollen offers a treasure trove of special plant nutrients. Here are some of the qualities that make Bee Pollen unique: 1. The nutrients found in Bee Pollen are extremely high quality. Not only does bee pollen...

Henan Weikang Bee Industry Co., Ltd.
Active Member

Henan

Wholesale Bee Pollen/Mixed Bee Pollen Powder from china suppliers

Place of Origin:China

Brand Name:J&S

Model Number:JSB-03

.../KOSHER:Yes Total Aerobic Plate Count:<1,000CFU/G Yeast & Mold:<100CFU/G Bee pollen is the pollen agglomerate which was collected from plant and processed by bees, and was called almighty nutrition food, concentrated natural drug

Ningbo J&S Botanics Inc.
Active Member

Zhejiang

Wholesale New Supplement ZI XIU TANG Bee Pollen Pills Weight Loss Pure natural honey beauty from china suppliers

Place of Origin:China

Brand Name:Bee Pollen Pills

Model Number:bee pollen weight loss pills

...New Supplement Bee Pollen Pills Weight Loss Zi Xiu Tang Flat belly, no arm flab and double chin, ZX Tang Bee Pollen help you say bye up to 30 pounds in 2 months, you will...

Green healthy living co.,LTD.
Active Member

Guangdong

Wholesale Mixed Bee Pollen from china suppliers

Model Number:DL-17

Brand Name:Deli

Place of Origin:Wuhu , Anhui , China (mainland)

...Product Specifications /Features Mixed Bee Pollen It has flavor of nature honey,strong natural taste and long sweet smell. Specification: Appearance: No foreign objects Colour: Yellow ODOR ...

Wuhu Deli Foods Co., Ltd
Active Member

Anhui

Wholesale Bee Pollen Tea bee pollen Mixed bee pollen Pure Rape bee pollen from china suppliers

Categories:products

Telephone:86-574-26865651

Country/Region:china

...Specification] Tea bee pollen, Mixed bee pollen, Pure Rape bee pollen, bee pollen Extract [Introduction] Bee pollen is the pollen agglomerate which was collected from plant and processed by bees, and was called almighty nutrition food, concentrated natural...

Ningbo J&S Botanics Inc.
Active Member

Zhejiang

Wholesale Bee pollen from china suppliers

Place of Origin:China

Brand Name:KINGHERBS

Model Number:BPP

...the bodies of bees. Bee pollen may also include bee saliva. It's important to avoid confusing bee pollen with natural honey, honeycomb, bee venom, or royal jelly. These products do no t contain bee pollen. How Is Bee Pollen Used? Bee pollen is available at...

Kingherbs Limited
Active Member

Hunan

Wholesale Bee pollen from china suppliers

Place of Origin:China

Brand Name:KINGHERBS

Model Number:BPP

...the bodies of bees. Bee pollen may also include bee saliva. It's important to avoid confusing bee pollen with natural honey, honeycomb, bee venom, or royal jelly. These products do no t contain bee pollen. How Is Bee Pollen Used? Bee pollen is available at...

Kingherbs Limited
Active Member

Hunan

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request