Sign In | Join Free | My fnxradio.com
fnxradio.com
Products
Search by Category

bee pollen

All bee pollen wholesalers & bee pollen manufacturers come from members. We doesn't provide bee pollen products or service, please contact them directly and verify their companies info carefully.

Total 4052 products from bee pollen Manufactures & Suppliers
Wholesale Natural Bee Propolis Powder Flavones Food Grade Ethyl Alcohol Colla Apis Extraction from china suppliers

Brand Name:Y-Herb

Model Number:10%-98%

Place of Origin:China

... Alcohol Colla Apis Extraction Organic Propolis Powder 10% PROPOLIS is a resinous mixture that honey bees collect from tree buds, sap flows, or other botanical sources. It is used as a sealant ...

Shaanxi Y-Herb Biotechnology Co., Ltd.
Verified Supplier

Wholesale Chinese Natural Bee Pollen Weight Loss Pills Bee Sexy BeeFit diet pills Bee Fit pills from china suppliers

Brand Name:Chinese Natural Bee Pollen Weight Loss Pills Bee Sexy BeeFit diet pills Bee Fit pills

Model Number:Chinese Natural Bee Pollen Weight Loss Pills Bee Sexy BeeFit diet pills Bee Fit pills

Place of Origin:HONGkONG

...Chinese Natural Bee Pollen Weight Loss Pills Bee Sexy and BeeFit diet pills Bee Fit pills Asset Royal Weight Loss Bee Pollen Slimming Capsule diet Pills OEM Private Labe Ingredients Main composition: 25%Bee Pollen, 17%Chinese yam...

Green healthy living international co., LTD
Verified Supplier

Hongkong

Wholesale China Manufactory Offer Pure Bee Pollen Powder from Bee Pollen Granules from china suppliers

Brand Name:SS-bee pollen powder

Model Number:2001

Place of Origin:Xuchang

...China Manufactory Offer Pure Bee Pollen Powder from Bee Pollen Granules We provide Rape pollen,Tea pollen,Sunflower pollen and Mixed pollen, Which are all collected from our professional and green beefarm---Henan beekeeping farm base,. We ...

Henan Super-Sweet Biotechnology Co., Ltd
Verified Supplier

Henan

Wholesale Mixed Sun Flower Bee Pollen Honey Bee Products Full Of Nutricion Big Granual from china suppliers

Brand Name:Bee Star

Model Number:HN-287-1

Place of Origin:China

...Mixed Sun Flower Bee Pollen of Honey Bee Products Descriptions of Mixed Sun Flower Bee Pollen: Bee pollen is a ball or pellet of field-gathered flower pollen packed by worker honeybees, and used as the primary food source...

Bee Star-----------Make Your Bees Be Great Star
Verified Supplier

Sichuan

Wholesale Wqs Model Chemical Machinery Equipment For Hemp Seed Bee Pollen from china suppliers

Place of Origin:Henan, China

Brand Name:OEM

...Wqs Model Chemical Machinery Equipment For Hemp Seed Bee Pollen Product Description WQS airflow screen is the abbreviation of horizontal airflow sieving machine. It is ...

Xinxiang Yihu Machinery Equipment Co.,Ltd
Verified Supplier

Henan

Wholesale ZI XIU TANG Bee Pollen Herbal Weight Loss Pills 100% Original Slimming Capsule from china suppliers

Brand Name:Zi xiu tang bee pollen herbal weight loss pill

Model Number:Z -313

Place of Origin:China

...ZI XIU TANG Bee Pollen herbal weight loss pill 100% original slimming capsule Are you suffering Yo-yo weight loss? Zi Xiu Tang Bee Pollen will let you get slender body in a short time...

Ali Healthcare Co., Ltd.
Verified Supplier

Guangdong

Wholesale Newest natrual multi-flower rape bee pollen from china suppliers

Place of Origin:Xuchang

Brand Name:bee pollen

Model Number:2001

...Newest natrual multi-flower rape bee pollen We could mix different kinds of pollen according customer`s requirement . For example : 60% rape pollen + 10% camellia pollen + 20% sunflowers+10% other bee pollen Please send us your requirement for...

Henan Super-Sweet Biotechnology Co., Ltd
Site Member

Henan

Wholesale pure clean rape bee pollen powder good for human consumption from china suppliers

Place of Origin:Xuchang

Brand Name:bee pollen

Model Number:2001

...pure clean rape bee pollen powder good for human consumption Product Description Product name Bee Pollen Appearance Light yellow block powder Odor Characteristic Taste Characteristic Active Ingredient Protein, Amino Acid, Vitamin, ...

Henan Super-Sweet Imp.&Exp. Trading Co., Ltd
Site Member

Henan

Wholesale Zi Xiu Tang / ZiXiuTang Bee Pollen Suppress Appetite Lose Weight from china suppliers

Brand Name:Zi Xiu Tang Bee Pollen

Model Number:emai: offer@slenderbeautybiotech.com

Place of Origin:kunming, yunan

Zi Xiu Tang Note Please send message to our email or skype directly, in case of the platform system problem. Contact Information Email: slenderbeautybiotech@yahoo.com Skype: slenderbeautybiotech Brands zixiutang Specification 48 pills or 60 pills Targeted...

Slender Beauty BioTech Co., Ltd
Site Member

Guangdong

Wholesale Bee pollen granules, Pollen granules, pollen pellet from china suppliers

Place of Origin:China

Brand Name:Zhanjo

Model Number:ZJ-1001

...: Bee pollen is the pollen agglomerate which was collected from plant and processed by bees, and was called almighty nutrition food, concentrated natural drug storeroom, to be taken orally cosmetic, concentrated amino acid etc, bee pollen...

Anhui Zhanjo Natural Product Co.,ltd
Site Member

Anhui

Wholesale Chinese Natural Salable Bee Pollen from china suppliers

Place of Origin:China

Brand Name:Weikang

...Function: 1. Promote the metabolism of skin cell and defer the cell senescence; 2. Bee pollen has the positive adjustment of nervous system which keep the head high energy; 3. Promote the ...

Henan Weikang Bee Industry Co.,Ltd.
Active Member

Henan

Wholesale Sell Bee Pollen in BULK-100%pure and Natural from china suppliers

Place of Origin:China

Brand Name:FengZhiDu

Model Number:FZD--200

... Place of origin: Brand name: fengzhidu / changsheng garden Packing details: Bulk, Bag, Bottle Classification: tea pollen, rape bee pollen,lotus bee pollen, corn bee pollen, Certification:

Henan Changsheng Garden Bee Products Co.,Ltd
Active Member

Henan

Wholesale Bee Pollen Gummi Candy from china suppliers

Place of Origin:PAN YU

Brand Name:HoToP, Gummi World, OEM, ODM

Model Number:HATOPS FOOD, FUN & HEALTHY

...BEE POLLEN GUMMI CANDY PRODUCT CONTAINS BEE POLLEN AND HERBAL EXTRACT THIS FORMULA CAN MAKE GUMMI BEAR, GUMMI DROP, GUMMI FISH. 10KG/BAG/...

Hatops Food, Fun & Healthy: Confectionery & Candy and more
Site Member

Wholesale Supply High Quality Bee Pollen Powder from china suppliers

Place of Origin:China

Brand Name:Reindeer

Model Number:Bee Pollen

...Product name Bee Pollen For Granules Description 1).Bees take pollen from the anthers on the flowers 2). The pollen is mixed with little honey and saliva secretions and made it into pollen bunch which is brought back...

Reindeer Biotech Co.,ltd
Active Member

Hunan

Wholesale High Quality Cheap Price Mixed Bee Pollen from china suppliers

Place of Origin:China

Brand Name:Fumei

Model Number:FMB201208241

... Description 1. long-term supply rape/tea/mixed bee pollen 2. free sample of rape/tea/mixed bee pollen available WhatisBeePollen? Beepollencontainstraceamountsofmineralsandvitaminsandisveryhighinproteinandcarbohydrates. Beepollenisnotfoundintheeverydaydiet...

Henan Fumei Bio - Technology Co., Ltd
Active Member

Henan

Wholesale Ultimate Formula Bee Pollen Weight Loss Diet Pill  Ultimate Formula Bee Pollen Weight Loss Slimming Capsules Single Box from china suppliers

Brand Name:ultimate slimming

Model Number:slimming capsules

Place of Origin:China

Product Description: The Ultimate formula utilizes safe and all natural Ingredients to successfully help men and women lose weight and inches while supporting an active lifestyle. These natural ingredients work together to assist the body in suppressing ...

Guangzhou Strong Power Trading Co.,Ltd
Site Member

Guangdong

Wholesale Zixiutang Bee Pollen Capsule Weight Loss Diet Pills Zi Xiu Tang Slimming Capsule from china suppliers

Place of Origin:Guangdong

Brand Name:Zixiutang Bee Pollen Capsule Weight Loss Diet Pills Zi Xiu Tang Slimming Capsule

...Zixiutang Bee Pollen Capsule Weight Loss Diet Pills Zi Xiu Tang Slimming Capsule Zixiutang Bee Pollen Capsule weight loss diet pills Zi Xiu Tang Slimming Capsule ZXTang Bee Pollen, Effective Slimming Capsules Specification: 60capsules/Bottle Age...

Green healthy living co.,LTD.
Active Member

Guangdong

Wholesale Bee Pollen from china suppliers

Place of Origin:Henan, China

Brand Name:weikang

Total Flavones: NLT200MG/100G Protein: >15.0% Moisture: 8.0%MAX Impurity: 1.0%MAX KOSHER or not/KOSHER: Yes Total Aerobic Plate Count: <1, 000CFU/G Yeast & Mold: <100CFU/G

Henan Weikang Bee Industry Co., Ltd
Active Member

Henan

Wholesale Zi Xiu Tang Bee Pollen from china suppliers

Model Number:Zi Xiu Tang Bee Pollen

Place of Origin:china

· THIS IS ORIGINAL PRODUCT FROM MANUFACTURER 48capsules/bottle This is an excellent way to weight loss and beauty and health. There is NO ANY SIDE-EFFECTS, It is also DIETARY SUPPLEMENTS. Not only it has WEIGHT LOSS FUNCTION, but also it has HEALTH ...

Natural Slimming International Ltd
Active Member

Natural Slimming International Ltd

Wholesale Bee pollen from china suppliers

Place of Origin:China

Brand Name:KINGHERBS

Model Number:BPP

... the bodies of bees. Bee pollen may also include bee saliva. It's important to avoid confusing bee pollen with natural honey, honeycomb, bee venom, or royal jelly. These products do no t contain bee pollen. How Is Bee Pollen Used? Bee pollen is available...

Kingherbs Limited
Active Member

Hunan

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request