Sign In | Join Free | My fnxradio.com
fnxradio.com
Products
Search by Category
Home > Chemicals > Oxide >

Does Cjc 1295 Work

does cjc 1295 work

All does cjc 1295 work wholesalers & does cjc 1295 work manufacturers come from members. We doesn't provide does cjc 1295 work products or service, please contact them directly and verify their companies info carefully.

Total 1421 products from does cjc 1295 work Manufactures & Suppliers
Best 87616-84-0 Human Peptides CJC-1295 Freeze-dried Powder For  Muscle Gain wholesale

Brand Name:Hongkong blue

Model Number:CJC-1295 87616-84-0

Place of Origin:CHINA

87616-84-0 Human Peptides CJC-1295 Freeze-dried Powder For Muscle Gain Why choose hongkong blue company and contact mabel ? Emai:mabel@sinosteroids.com Skype:mabel_1044 1.Best ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Best GMP Certified Peptide Steroid Hormones Cjc 1295 with Dac Raw Hormone Powders wholesale

Brand Name:Gear steroids

Model Number:1045-69-8

Place of Origin:China

GMP Certified Peptide Steroid Hormones Cjc 1295 with Dac Raw Hormone Powders CJC-1295 Peptide Profile CJC-1295 is an injectable peptide used to increase GH production. This peptide ...

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier

Shanghai

Best Muscle Mass Human Growth Hormone Steroids CJC-1295 Without DAC Peptide wholesale

Brand Name:KANGDISEN

Model Number:2 mg/vial

Place of Origin:China

Muscle Mass Human Growth Hormone Steroids CJC-1295 Without DAC Peptide Modified GRF (1-29), CJC-1295 no DAC Modified Growth Releasing Factor aminos 1-29, usually referred to as ...

Hongkong Kangdisen Medical Co., Limited
Verified Supplier

Hong Kong

Best Cjc-1295 Peptide Human Growth Steroid Cjc-1295 Without Dac for Muscle Enhance wholesale

Brand Name:wumeitech

Model Number:Cjc-1295

Place of Origin:China

Cjc-1295 Peptide Human Growth Steroid Cjc-1295 Without Dac for Muscle Enhance CJC-1295 Product name: CJC-1295 Acetate CJC-1295 Alias:GHRH, Growth Hormone Releasing Hormones,MOD GRF ...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Best CAS 863288-34-0 Natural Peptide Hormones CJC-1295 Powder For Muscle Gain wholesale

Brand Name:JNJG

Model Number:CAS 863288-34-0

Place of Origin:CHINA

CAS 863288-34-0 Natural Peptide Hormones CJC-1295 Powder For Muscle Gain Product Name CJC-1295 Acetate Alias GHRH CAS 863288-34-0 Purity 98% Storage Shading, Confined Preservation ...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Best Anti Estrogen CJC 1295 Peptides Steroids Supplements For Building Muscle / Fat Burning wholesale

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

Lyophilized Powder CJC-1295 Peptide Growth Hormone CJC 1295 W/O DAC Fat Loss 1. What is CJC 1295 CJC 1295 is an injectable peptide used to increase GH production. This peptide is a ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Best Human Growth Hormone Peptide CJC 1295 No DAC For Body Performance Enhancement wholesale

Brand Name:Pharmlab

Model Number:863288-34-0

Place of Origin:China

Human Growth Hormone Peptide CJC 1295 No DAC For Body Performance Enhancement 1.Quick detail Product name : CJC-1295 without dac Synonyms: CJC-1295 without DAC, CJC 1295 w/o DAC ...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Best CJC-1295 DAC Bodybuilding Supplements Increase GHRP Production Injection wholesale

Brand Name:Grand Uni or OEM

Model Number:CAS:863288-34-0

Place of Origin:China

CJC-1295 DAC Bodybuilding Supplements Increase GHRP Production Injection Quick Detail : CJC-1295 Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser...

GRAND UNIVERSE INDUSTRIAL LIMITED
Verified Supplier

Guangdong

Best 51753-57-2 Polypeptide Hormones 99.5% 2mg / Vial Peptide CJC-1295 Without DAC GHRH   wholesale

Brand Name:pharm-china

Model Number:51753-57-2

Place of Origin:China

99.5% 2mg/Vial Peptide CJC-1295 Without DAC GHRH CAS 51753-57-2 Polypeptide Hormones For Losing Fat&Healthy Care Basic View : CJC-1295 without DAC (2mg/Vial / 10vial/Kit) Sequence...

Shanghai Yijing Pharmaceutical Co.,Ltd
Verified Supplier

Shanghai

Best 99.5% Human Growth Hormone Peptide CJC-1295 Without DAC 51753-57-2 wholesale

Brand Name:BOF

Model Number:51753-57-2

Place of Origin:China

99.5% Human Growth Hormone Peptide CJC-1295 Without DAC 51753-57-2 Basic View : CJC-1295 without DAC (2mg/Vial / 10vial/Kit) Sequence:Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

Best 51753-57-2 Growth Hormone Peptides Mod Grf 1-29 Releasing Cjc -1295 Without Dac wholesale

Brand Name:HZ

Model Number:51753-57-2

Place of Origin:China

51753-57-2 Growth Hormone Peptides Mod Grf 1-29 Releasing Cjc -1295 Without Dac Synonyms: CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, Neorelin, Modified Sermorelin CAS NO...

Wuhan Hezhong Biochemical Manufacturing Co., Ltd.
Verified Supplier

Hubei

Best Peptide Steroid hormones Lyophilized Powder Cjc 1295 Without Dac for Gh Releasing wholesale

Brand Name:YCGC

Model Number:Cjc 1295 Without Dac

Place of Origin:Wuhan, Hubei, China

Peptide Steroid hormones Lyophilized Powder Cjc 1295 Without Dac for Gh Releasing Basic Info MOQ:10vails/1kit Transport Package:Discreet Packing Ways for Your Choice Specification...

Wuhan Yuancheng Gongchuang Technology Co., Ltd.
Verified Supplier

Hubei

Best Pure CJC-1295 Without DAC 2mg Growth Hormone Releasing Peptide Fat Loss wholesale

Brand Name:Blue Dragon

Model Number:CJC-1295 (Without/ No DAC) 2mg

Place of Origin:China Manufacturer

1, CJC-1295 (Without/ No DAC) Profile: Product Name: CJC-1295 Without DAC Specification: 2mg per vial Synonyms: CJC-1295 Acetate; CJC-1295; CJC-1295 No DAC, CJC-1295 W/O DAC, ...

Zhuhaishi Shuangbojie Technology Co., Ltd.
Verified Supplier

Guangdong

Best CJC-1295 Without DAC 863288-34-0 Releasing Hormones (GHRH) purity 98% wholesale

Brand Name:ChineseHormone

Model Number:863288-34-0

Place of Origin:China

CJC-1295 Without DAC Cas No.: 863288-34-0 Releasing Hormones (GHRH) 98% CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Releasing Hormones (GHRH). Their action ...

HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
Verified Supplier

Hong Kong

Best CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production wholesale

Brand Name:NJBN STEROID

Model Number:863288-34-0

Place of Origin:MADE IN CHINA

Hot Sell Body Building Peptides CAS 863288-34-0 CJC-1295 for Increase GH Production Quick Detail: Product Name CJC1295 Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L...

Nanjing Bangnuo Biotechnology Co., Ltd
Verified Supplier

Jiangsu

Best 99% Effective Steroid Hormone Peptide Powder CJC-1295 Acetate CAS 863288-34-0 wholesale

Brand Name:www.steroidaily.com

Model Number:863288-34-0

Place of Origin:china manufactuer

99% Effective Steroid Hormone Peptide Powder CJC-1295 Acetate CAS 863288-34-0 Cjc-1295 Acetate Alias: CJC-1295 Acetate; CJC1295(Without DAC); Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Best Muscle Gains Polypeptide Hormone CJC-1295 Without DAC White Powder wholesale

Brand Name:Simeiquan

Model Number:CAS:863288-34-0

Place of Origin:China

Polypeptide Hormone CJC-1295 without DAC / CJC 1295 w/o DAC / MOD GRF 1-29 / C JC-1295 No DAC 2mg/vail for Muscle Gains with Fast and Safe Delivery E-mail: claire@chembj.com Skype: ...

Shenzhen Simeiquan Biotechnology Co., Ltd.
Verified Supplier

Guangdong

Best CJC 1295 Nutrition Fitness Peptide Growth Hormone 2mg / Vial CAS 863288-34-0 wholesale

Brand Name:YIHAN

Model Number:CJC -1295

Place of Origin:China

CJC 1295 Nutrition Fitness Peptide Growth Hormone 2mg / Vial CAS 863288-34-0 CJC-1295 Alias: CJC-1295 Acetate; CJC1295(Without DAC); Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Best White Raw Peptide Powder , Fat Loss CJC -1295 Human Growth Steroids with DAC 2mg / vial wholesale

Brand Name:LSW

Model Number:LSW-129-1

Place of Origin:China

Peptide CJC-1295 2mg/vial for Fat Loss and Muscle Gain Description CJC-1295 DAC as a growth hormone releasing hormone (GHRH) analog. Not only has CJC-1295 increase growth hormone ...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hong Kong

Best Purity 98% Injectable Anabolic Human Growth Bodybuliding Hormone Cjc-1295 (DAC) wholesale

Brand Name:Nanjian

Model Number:Wuhan2017022

Place of Origin:China

Injectable Anabolic Human Growth Bodybuliding Hormone CAS: 863288-34-0 Cjc-1295 (DAC) Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg...

Tai'an Jia Ye Biological Technology Co.,Ltd
Verified Supplier

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request