Sign In | Join Free | My fnxradio.com
fnxradio.com
Products
Search by Category
Home > Chemicals > Alkyne >

Does Cjc 1295 Work

does cjc 1295 work

All does cjc 1295 work wholesalers & does cjc 1295 work manufacturers come from members. We doesn't provide does cjc 1295 work products or service, please contact them directly and verify their companies info carefully.

Total 2985 products from does cjc 1295 work Manufactures & Suppliers
Wholesale 10mg/Vial CJC-1295 Polypeptide Hormones For Muscle Building CAS 863288-34-0 from china suppliers

Brand Name:YUANHANG

Model Number:863288-34-0

Place of Origin:CHINA

... Weight Loss Muscle Building What is CJC 1295? CJC-1295 is a hormone growth product. It is classified under the peptide category. Your aim is to build your body with CJC-1295. How it assists you to...

Yuanhang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Wholesale CAS 863288-34-0 Peptides Steroids Powder Cjc-1295 No Dac for Muscle Enhance from china suppliers

Brand Name:HKYC

Model Number:PEPTIDE POWDER

Place of Origin:HUBEI,CHINA

...CJC1295 Human Growth Peptide Steroid Cjc-1295 No Dac for Muscle Enhance CJC 1295 No DAC Basic Info Name CJC 1295 Alias CJC-1295 No DAC, CJC-1295 without DAC,Mod GRF 1-29 CAS 863288-34-0 M. F C152H252N44O42 M. W 3367.2 Purity (HPLC...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Wholesale Effective CJC 1295 without DAC Growth Hormones Peptide supplements Lyophilized Powder for increasing muscle mass from china suppliers

Brand Name:LSW

Model Number:CJC 1295 Lyophilized Powder In Vials / Pure Raw Powder No Vial

Place of Origin:China

...99% purity CJC 1295 no DAC Growth Hormones Peptide Modified GRF 1-29 CJC1295 W / O DAC 2mg / Vial Product Name CJC 1295 Also known as CJC 1295 no DAC,CJC-1295 Without DAC, CJC no DAC, Modified GRF 1-29, Mod GRF...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hubei

Wholesale CJC 1295 DAC Human Growth White Peptide Powder 2mg CJC1295 With DAC from china suppliers

Brand Name:JNJG

Model Number:CJC-1295 with DAC

Place of Origin:CHINA

...CJC 1295 DAC Human Growth White Peptide Powder 2mg CJC1295 With DAC Quick Detail: other name CJC1295dac, CJC1295withDAC Product Description CJC-1295 2mg/Vial Standard Medicine Grade MF C165H271N47O46 Molecular Weight 3649.30 Purity...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Wholesale Legit CJC-1295 without DAC MOD GRF 1-29 Peptide Hormone Powder For Increasing Growth Hormone from china suppliers

Brand Name:MOD GRF 1-29

Model Number:MOD GRF 1-29

Place of Origin:China

... Hormone Quick details: Product name: CJC-1295 without DAC Alias: MOD GRF 1-29 CAS NO.: 863288-34-0 Assay: 99%min Appearance: White powder Grade: Pharmaceutical Grade CJC-1295 main details CJC-1295 is basically a peptide hormone...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Wholesale CJC-1295 Acetate with Dac 863288-34-0 Growth Hormone for Muscle Enhance from china suppliers

Brand Name:ChineseHormone

Model Number:863288-34-0

Place of Origin:China

...CJC-1295 Acetate with Dac 863288-34-0 Growth Hormone for Muscle Enhance CJC-1295 is a terasubstitute 30 amino acid peptide hormone and acts as an analogue of growth hormone secretion. The main use of CJC-1295...

Hengyang Desen Biotechnology Co., Ltd.
Verified Supplier

Hunan

Wholesale Peptide Hormones Bodybuilding GHRH CJC-1295 with DAC For Increases Protein Synthesis from china suppliers

Brand Name:wumeitech

Model Number:863288-34-0

Place of Origin:China

.../vial Cjc-1295 with Dac for Fat Burning 2mg/Vial Legal Safe Peptide CJC-1295 Acetate with Dac Muscle Growth Polypeptide Materials Human Growth Hormone Peptide Manufacturer Supply Cjc-1295 Without Dac with Over 98% Purity CJC-1295...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Wholesale 87616-84-0 Human Peptides CJC-1295 Freeze-dried Powder For  Muscle Gain from china suppliers

Brand Name:Hongkong blue

Model Number:CJC-1295 87616-84-0

Place of Origin:CHINA

...87616-84-0 Human Peptides CJC-1295 Freeze-dried Powder For Muscle Gain Why choose hongkong blue company and contact mabel ? Emai:...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Wholesale CJC1295 Without DAC High purity legal peptides Steroids CJC-1295 Without DAC​​​ 2mg / Vial 863288-34-0 from china suppliers

Brand Name:CJC-1295 Without DAC

Model Number:863288-34-0

Place of Origin:China

...High purity legal peptides Steroids CJC-1295 Without DAC​​​ 2mg / Vial , CAS 863288-34-0 Not only has Cjc1295 shown the ability to ...

JCJ Logis Co.,ltd
Verified Supplier

Hubei

Wholesale CAS 863288-34-0 Human Growth Hormone Peptide with DAC 2mg CJC-1295 DAC from china suppliers

Brand Name:Pharmlab

Model Number:863288-34-0

Place of Origin:China

...99% Human Growth Peptide CJC-1295 with DAC 2mg CAS 863288-34-0 for Muscle Growth CJC-1295 DAC Quick detail Product Name CJC-1295 With DAC CAS Number 863288-34-0 Molecular Formula C165H269N47O46 Molecular Weight 873...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Wholesale Muscle Building Protein Peptide Hormones Lyophilized Powder Cjc-1295 Dac with GMP from china suppliers

Brand Name:Muscle Man

Model Number:863288-34-0

Place of Origin:Hunan,China

... Hormones Lyophilized Powder Cjc-1295 Dac with GMP For Muscle Building Product Quick Detail: Product Name CJC1295 with DAC Unit Size 2mg per vial CAS No. 863288-34-0 Synomyms CJC-1295 DAC, CJC 1295 with DAC...

Zhuzhou Interial Biotechnology Co., Ltd
Verified Supplier

Hunan

Wholesale Growth Hormone Muscle Building Peptides CJC 1295 with Dac 2mgvial from china suppliers

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

...Growth Hormone Muscle Building Peptides CJC 1295 with Dac 2mgvial 1. CJC 1295 DOSES Modified GRF 1-29(cjc1295 w/o DAC): Dose per injection: 100mcg Injections per vial: 20 x 100mcg ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Wholesale CAS 51753-57-2 Human Growth Peptides Cjc-1295 with Dac 2mg / Vial for Weight Loss from china suppliers

Brand Name:Gear Steroids

Model Number:51753-57-2

Place of Origin:China

... 1, Basic Info. Model NO.: Cjc-1295 Customized: Customized Suitable for: Elderly, Adult Purity: >99% MOQ: 1 kit Material: Pharmaceutical Raw Material Reship: Available Usage: for Lean Muscle Shipping Time: 3~7 Working days Specification: USP28 HS...

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier

Shanghai

Wholesale CJC-1295 DAC Bodybuilding Supplements Increase GHRP Production Injection from china suppliers

Brand Name:Grand Uni or OEM

Model Number:CAS:863288-34-0

Place of Origin:China

...-Ile-Leu-Ser-Arg-LysLys(Maleimidopropionyl)-NH2 (Drug Affinity Complex) CJC-1295 Molecular formula: C165H269N47O46 CJC-1295 Molar Mass: 3647.15 CJC-1295 CAS number: 863288-34-0 CJC-1295 is an injectable peptide used to increase GH production.

GRAND UNIVERSE INDUSTRIAL LIMITED
Verified Supplier

Guangdong

Wholesale CJC 1295 Nutrition Fitness Peptide Growth Hormone 2mg / Vial CAS 863288-34-0 from china suppliers

Brand Name:YIHAN

Model Number:CJC -1295

Place of Origin:China

...CJC 1295 Nutrition Fitness Peptide Growth Hormone 2mg / Vial CAS 863288-34-0 CJC-1295 Alias: CJC-1295 Acetate; CJC1295(Without DAC); Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Wholesale Pure CJC-1295 Without DAC 2mg Growth Hormone Releasing Peptide Fat Loss from china suppliers

Brand Name:Blue Dragon

Model Number:CJC-1295 (Without/ No DAC) 2mg

Place of Origin:China Manufacturer

...CJC-1295 (Without/ No DAC) Profile: Product Name: CJC-1295 Without DAC Specification: 2mg per vial Synonyms: CJC-1295 Acetate; CJC-1295; CJC-1295 No DAC, CJC-1295 W/O DAC, Modified GRF (1-29) CAS No.: 863288-34-0 MF: C152H252N44O42 MW: 3367.97 Sequence...

Zhuhaishi Shuangbojie Technology Co., Ltd.
Verified Supplier

Guangdong

Wholesale Human Growth Peptides CJC-1295 Acetate cjc1295 DAC 2mg/vial,863288-34-0 from china suppliers

Brand Name:YC

Model Number:863288-34-0

Place of Origin:China

... name: CJC-1295 Acetate Alias:GHRH, Growth Hormone Releasing Hormones,MOD GRF 1-29 CAS Registry Number: 863288-34-0 Appearance: White Powder Purity:98% Grade: Pharmaceutical Grade Storage: Shading, confined preservation CJC-1295 Effect CJC-1295 is...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Wholesale 2mg CJC 1295 without DAC CAS 863288-34-0 Peptide Steroid Hormones CJC 1295 White Powder from china suppliers

Brand Name:Zhenxiang

Model Number:CAS: 863288-34-0

Place of Origin:CHINA

...2mg CJC 1295 without DAC CAS: 863288-34-0 Peptide Steroid Hormones CJC 1295 White Powder Quick Detail; Product name: CJC 1295 without DAC/ CJC 1295 DAC CAS: 863288-34-0 Formula: C152H252N44O42 Molecular weight: 3367.2 purity: > 98.0% Appearance: White...

Changsha Zhenxiang Biotechnology Co., Ltd.
Verified Supplier

Hunan

Wholesale Bodybuilding Hormone Supplements Growth Hormone Peptides Injection CJC 1295 DAC from china suppliers

Brand Name:Shanghai Stero

Model Number:CJC 1295 DAC

Place of Origin:China

...Bodybuilding Hormone Supplements Growth Hormone Peptides Injection CJC 1295 DAC Description: CJC-1295 with DAC is a peptide known to help in promoting muscle gain, muscle strength, lean body ...

Shanghai Stero R&D Co,. Ltd
Verified Supplier

Shanghai

Wholesale CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production from china suppliers

Brand Name:NJBN STEROID

Model Number:863288-34-0

Place of Origin:MADE IN CHINA

...Hot Sell Body Building Peptides CAS 863288-34-0 CJC-1295 for Increase GH Production Quick Detail: Product Name CJC1295 Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-...

Nanjing Bangnuo Biotechnology Co., Ltd
Verified Supplier

Jiangsu

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request